Accugel 29:1 (40%)

Accugel 29:1 (40%) 

To Order Contact us: lieven@wlsolutions.be

450ML AccuGel 29:1 (30%)

NAT1184 450ML
EUR 105

1L AccuGel 29:1 (30%)

NAT1186 1L
EUR 138

450ML AccuGel 19:1 (40%)

NAT1180 450ML
EUR 109

1L AccuGel 19:1 (40%)

NAT1182 1L
EUR 140

β-Amyloid (29-40)

HY-P1522 5mg
EUR 326

Acrylamide : bis 40%, 29:1 Solution

A0421-050 495ml
EUR 151

Acrylamide : bis 40%, 29:1 Solution

A0421-100 2x495ml
EUR 223

Acrylamide : bis 40%, 29:1 Solution

A0421-200 4x495ml
EUR 361

Amyloid beta-Protein (29-40)

5-00665 4 x 1mg Ask for price

Amyloid b-Protein (29-40)

H-3984.0001 1.0mg
EUR 120
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]

Amyloid b-Protein (29-40)

H-3984.0005 5.0mg
EUR 393
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]

450ML AccuGel 19:1 (30%)

NAT1176 450ML
EUR 105

1L AccuGel 19:1 (30%)

NAT1178 1L
EUR 138

Nogo-66 (1-40)

B5247-1 1 mg
EUR 609

Galanin (1-29) (rat, mouse)

B5325-1 1 mg
EUR 399

Acryl/Bis solution (29:1), 40% (w/v)

A0007 500ml
EUR 77.84

FUNNEL, 40 MM, PP

6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels

IL-29 Interleukin-29 Human Recombinant Protein

PROTQ8IU54-1 Regular: 20ug
EUR 317
Description: IL-29 human recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.

40 x ELISA Wash Buffer

GR103014-40 1 L
EUR 199

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

CMV (Cytomegalovirus Antibody IgM) ELISA test

29 96T/Box Ask for price
Description: ELISA based test for quantitative detection of CMV (Cytomegalovirus Antibody IgM)

des-His1-[Glu9]-Glucagon (1-29) amide

B5273-1 1 mg
EUR 535

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 479
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 621
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 489
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 635
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 508
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 661
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Galanin (2-29) (rat)

B5116-1 1 mg
EUR 730

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm

GFL-40 1 mL
EUR 1053

[D-Ala2]-GRF (1-29) amide (human)

SP-89085-1 1 mg
EUR 286

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm

GPK-40 1 kit
EUR 715

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 383

Amyloid ?-Protein (29-40) (AA: Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val) (MW: 1085.38)

SP-62497-1 1 mg
EUR 164

CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER

9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)

K1230-40
EUR 1061

Accugel 29:1 (40%)