Accugel 29:1 (40%)

Accugel 29:1 (40%) 

To Order Contact us: lieven@wlsolutions.be

450ML AccuGel 29:1 (30%)

NAT1184 450ML
EUR 71.82

1L AccuGel 29:1 (30%)

NAT1186 1L
EUR 119.7

450ML AccuGel 19:1 (40%)

NAT1180 450ML
EUR 80.94

1L AccuGel 19:1 (40%)

NAT1182 1L
EUR 118.56

β-Amyloid (29-40)

HY-P1522 5mg
EUR 391.2

Acrylamide : bis 40%, 29:1 Solution

A0421-050 495ml
EUR 181.2

Acrylamide : bis 40%, 29:1 Solution

A0421-100 2x495ml
EUR 267.6

Acrylamide : bis 40%, 29:1 Solution

A0421-200 4x495ml
EUR 433.2

Amyloid beta-Protein (29-40)

5-00665 4 x 1mg Ask for price

Amyloid b-Protein (29-40)

H-3984.0001 1.0mg
EUR 144
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]

Amyloid b-Protein (29-40)

H-3984.0005 5.0mg
EUR 471.6
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]

Nogo-66 (1-40)

B5247-1 1 mg
EUR 730.8

450ML AccuGel 19:1 (30%)

NAT1176 450ML
EUR 75.24

1L AccuGel 19:1 (30%)

NAT1178 1L
EUR 119.7

Galanin (1-29) (rat, mouse)

B5325-1 1 mg
EUR 478.8

Acryl/Bis solution (29:1), 40% (w/v)

A0007 500ml
EUR 93.41

Acrylamide/Bis Acrylamide 40% (29:1), Sterile solution

18-197 500ml/Unit
EUR 339

FUNNEL, 40 MM, PP

6120P-40 24/pk
EUR 52.8
Description: Reusable Plastics; Reusable Funnels

IL-29 Interleukin-29 Human Recombinant Protein

PROTQ8IU54-1 Regular: 20ug
EUR 380.4
Description: IL-29 human recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.

40 x ELISA Wash Buffer

GR103014-40 1 L
EUR 238.8

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Anti-Dog CRP Antibody | RCRP-40

RCRP-40 1.0 mL
EUR 153
Description:

Anti-Dog CRP Antibody | RCRP-40 | Immunology Consultants Laboratory

Host: Rabbit

Format: Whole Serum

Product Type: Primary Antibody

Antibody Clonality: Polyclonal

Anti-Dog CRP Antibody | GCRP-40

GCRP-40 1.0 mL
EUR 145
Description:

Anti-Dog CRP Antibody | GCRP-40 | Immunology Consultants Laboratory

Host: Goat

Format: Whole Serum

Product Type: Primary Antibody

Antibody Clonality: Polyclonal

des-His1-[Glu9]-Glucagon (1-29) amide

B5273-1 1 mg
EUR 642

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 574.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 745.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 586.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 762
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 609.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 793.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 830.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 613.2

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 850.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 890.4

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 794.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 586.8

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 812.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 850.8

CMV (Cytomegalovirus Antibody IgM) ELISA test

29 96T/Box Ask for price
Description: ELISA based test for quantitative detection of CMV (Cytomegalovirus Antibody IgM)

Galanin (2-29) (rat)

B5116-1 1 mg
EUR 876

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm

GFL-40 1 mL
EUR 1263.6

Turbidity Std Ratio 40 NTU

CRSR-40-100 100ML
EUR 125.4

Turbidity Std Ratio 40 NTU

CRSR-40-1000 1L
EUR 557.46

Turbidity Std Ratio 40 NTU

CRSR-40-500 500ML
EUR 248.52

Accugel 29:1 (40%)