Accugel 29:1 (40%)
To Order Contact us: lieven@wlsolutions.be
450ML AccuGel 29:1 (30%) |
||
NAT1184 | 450ML | EUR 71.82 |
1L AccuGel 29:1 (30%) |
||
NAT1186 | 1L | EUR 119.7 |
450ML AccuGel 19:1 (40%) |
||
NAT1180 | 450ML | EUR 80.94 |
1L AccuGel 19:1 (40%) |
||
NAT1182 | 1L | EUR 118.56 |
β-Amyloid (29-40) |
||
HY-P1522 | 5mg | EUR 391.2 |
Acrylamide : bis 40%, 29:1 Solution |
||
A0421-050 | 495ml | EUR 181.2 |
Acrylamide : bis 40%, 29:1 Solution |
||
A0421-100 | 2x495ml | EUR 267.6 |
Acrylamide : bis 40%, 29:1 Solution |
||
A0421-200 | 4x495ml | EUR 433.2 |
Amyloid beta-Protein (29-40) |
||
5-00665 | 4 x 1mg | Ask for price |
Amyloid b-Protein (29-40) |
||
H-3984.0001 | 1.0mg | EUR 144 |
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1] |
Amyloid b-Protein (29-40) |
||
H-3984.0005 | 5.0mg | EUR 471.6 |
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1] |
Nogo-66 (1-40) |
||
B5247-1 | 1 mg | EUR 730.8 |
450ML AccuGel 19:1 (30%) |
||
NAT1176 | 450ML | EUR 75.24 |
1L AccuGel 19:1 (30%) |
||
NAT1178 | 1L | EUR 119.7 |
Galanin (1-29) (rat, mouse) |
||
B5325-1 | 1 mg | EUR 478.8 |
Acryl/Bis solution (29:1), 40% (w/v) |
||
A0007 | 500ml | EUR 93.41 |
Acrylamide/Bis Acrylamide 40% (29:1), Sterile solution |
||
18-197 | 500ml/Unit | EUR 339 |
FUNNEL, 40 MM, PP |
||
6120P-40 | 24/pk | EUR 52.8 |
Description: Reusable Plastics; Reusable Funnels |
IL-29 Interleukin-29 Human Recombinant Protein |
||
PROTQ8IU54-1 | Regular: 20ug | EUR 380.4 |
Description: IL-29 human recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. |
40 x ELISA Wash Buffer |
||
GR103014-40 | 1 L | EUR 238.8 |
Amyloid Beta-Peptide (1-40) (human) |
||
A1124-1 | 1 mg | EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Anti-Dog CRP Antibody | RCRP-40 |
||
RCRP-40 | 1.0 mL | EUR 153 |
Description: Anti-Dog CRP Antibody | RCRP-40 | Immunology Consultants Laboratory Host: Rabbit Format: Whole Serum Product Type: Primary Antibody Antibody Clonality: Polyclonal |
Anti-Dog CRP Antibody | GCRP-40 |
||
GCRP-40 | 1.0 mL | EUR 145 |
Description: Anti-Dog CRP Antibody | GCRP-40 | Immunology Consultants Laboratory Host: Goat Format: Whole Serum Product Type: Primary Antibody Antibody Clonality: Polyclonal |
des-His1-[Glu9]-Glucagon (1-29) amide |
||
B5273-1 | 1 mg | EUR 642 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Hu-48T | 48T | EUR 574.8 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Hu-96T | 96T | EUR 745.2 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Mu-48T | 48T | EUR 586.8 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Mu-96T | 96T | EUR 762 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Ra-48T | 48T | EUR 609.6 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
DLR-Ab1-40-Ra-96T | 96T | EUR 793.2 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Hu-48Tests | 48 Tests | EUR 600 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Hu-96Tests | 96 Tests | EUR 830.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Mu-48Tests | 48 Tests | EUR 613.2 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Mu-96Tests | 96 Tests | EUR 850.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Ra-48Tests | 48 Tests | EUR 640.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RDR-Ab1-40-Ra-96Tests | 96 Tests | EUR 890.4 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Hu-48Tests | 48 Tests | EUR 573.6 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Hu-96Tests | 96 Tests | EUR 794.4 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Mu-48Tests | 48 Tests | EUR 586.8 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Mu-96Tests | 96 Tests | EUR 812.4 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Ra-48Tests | 48 Tests | EUR 613.2 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
||
RD-Ab1-40-Ra-96Tests | 96 Tests | EUR 850.8 |
CMV (Cytomegalovirus Antibody IgM) ELISA test |
||
29 | 96T/Box | Ask for price |
Description: ELISA based test for quantitative detection of CMV (Cytomegalovirus Antibody IgM) |
Galanin (2-29) (rat) |
||
B5116-1 | 1 mg | EUR 876 |
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm |
||
GFL-40 | 1 mL | EUR 1263.6 |
Turbidity Std Ratio 40 NTU |
||
CRSR-40-100 | 100ML | EUR 125.4 |
Turbidity Std Ratio 40 NTU |
||
CRSR-40-1000 | 1L | EUR 557.46 |
Turbidity Std Ratio 40 NTU |
||
CRSR-40-500 | 500ML | EUR 248.52 |