Accugel 29:1 (40%)

Accugel 29:1 (40%) 

To Order Contact us: lieven@wlsolutions.be

1L AccuGel 29:1 (40%)
NAT1190 1L
EUR 140
450ML AccuGel 29:1 (30%)
NAT1184 450ML
EUR 105
1L AccuGel 29:1 (30%)
NAT1186 1L
EUR 138
450ML AccuGel 19:1 (40%)
NAT1180 450ML
EUR 109
1L AccuGel 19:1 (40%)
NAT1182 1L
EUR 140
β-Amyloid (29-40)
HY-P1522 5mg
EUR 326
Acrylamide : bis 40%, 29:1 Solution
A0421-050 495ml
EUR 151
Acrylamide : bis 40%, 29:1 Solution
A0421-100 2x495ml
EUR 223
Acrylamide : bis 40%, 29:1 Solution
A0421-200 4x495ml
EUR 361
FUNNEL, 40 MM, PP
6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels
Amyloid beta-Protein (29-40)
5-00665 4 x 1mg Ask for price
Amyloid b-Protein (29-40)
H-3984.0001 1.0mg
EUR 120
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]
Amyloid b-Protein (29-40)
H-3984.0005 5.0mg
EUR 393
Description: Sum Formula: C49H88N12O13S; CAS# [184865-04-1]
450ML AccuGel 19:1 (30%)
NAT1176 450ML
EUR 105
1L AccuGel 19:1 (30%)
NAT1178 1L
EUR 138
Nogo-66 (1-40)
B5247-1 1 mg
EUR 609
Galanin (1-29) (rat, mouse)
B5325-1 1 mg
EUR 399
Acryl/Bis solution (29:1), 40% (w/v)
A0007 500ml
EUR 77.84
  • Product category: Electrophoresis Related/Acry/Bis-Acrylamide/Acryl/Bis
IL-29 Interleukin-29 Human Recombinant Protein
PROTQ8IU54-1 Regular: 20ug
EUR 317
Description: IL-29 human recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40 1 mL
EUR 1053
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T 48T
EUR 479
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T 96T
EUR 621
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T 48T
EUR 489
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T 96T
EUR 635
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T 48T
EUR 508
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T 96T
EUR 661
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742
DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40 1 kit
EUR 715
Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
des-His1-[Glu9]-Glucagon (1-29) amide
B5273-1 1 mg
EUR 535
CMV (Cytomegalovirus Antibody IgM) ELISA test
29 96T/Box Ask for price
  • Area of application: Prepotency testing
Description: ELISA based test for quantitative detection of CMV (Cytomegalovirus Antibody IgM)
Galanin (2-29) (rat)
B5116-1 1 mg
EUR 730
[D-Ala2]-GRF (1-29) amide (human)
SP-89085-1 1 mg
EUR 286
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40
EUR 1061
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40
EUR 1061
40 bp random library with flanking sequence; DNA aptamer
DAL-N-40 100 ug
EUR 408

Accugel 29:1 (40%)