Bridge-It SAM 384

Bridge-It SAM 384 

To Order Contact us: lieven@wlsolutions.be

TR-FRET Bridge-It L-MET 50

TRF-1-1-1005A 1 Kit
EUR 345.6

TR-FRET Bridge-It L-MET 96

TRF-1-1-1005B 1 Kit
EUR 578.4

TR-FRET Bridge-It L-MET 100

TRF-1-1-1006A 1 Kit
EUR 286.8

TR-FRET Bridge-It L-Tryptophan 50

TRF-1-1-1001A 1 Kit
EUR 345.6

TR-FRET Bridge-It L-Tryptophan 96

TRF-1-1-1001B 1 Kit
EUR 578.4

TR-FRET Bridge-It L-Tryptophan 100

TRF-1-1-1002A 1 Kit
EUR 286.8

Bridge-ItSAM50

1-1-1003A each
EUR 170
Description: 10 mM S-adenosyl methionine standard in 10mM 2-mercaptoethanol, SAM Assay Solution, Buffer S, Buffer CM

Bridge-ItSAM96

1-1-1003B each
EUR 318.75
Description: 10 mM S-adenosyl methionine standard in 10mM 2-mercaptoethanol, SAM Assay Solution, Buffer S, Buffer CM

Bridge-ItSAM100

1-1-1004A each
EUR 148.75
Description: 10 mM S-adenosyl methionine standard in 10mM 2-mercaptoethanol, SAM Assay Solution, Buffer S, Buffer CM

Bridge-ItSAM384

1-1-1004B each
EUR 420.75
Description: 10 mM S-adenosyl methionine standard in 10mM 2-mercaptoethanol, SAM Assay Solution, Buffer S, Buffer CM

Bridge-ItcAMP50

122934 each
EUR 170
Description: 10uM cAMP stock standard in H2O, Assay Solution A, 10X Lysis Buffer, Buffer B, 10X KRB-IBMXBuffer

Bridge-ItcAMP96

122935 each
EUR 318.75
Description: 10uM cAMP stock standard in H2O, Assay Solution A, 10X Lysis Buffer, Buffer B, 10X KRB-IBMXBuffer

Bridge-ItcAMP384

122938 each
EUR 420.75
Description: 10uM cAMP stock standard in H2O, 2X Assay Solution A, 10X Lysis Buffer, Buffer B

Bridge-ItcAMP100

122939 each
EUR 148.75
Description: 10uM cAMP stock standard in H2O, 2X Assay Solution A, 10X Lysis Buffer, Buffer B

Bridge-ItL-MET50

1-1-1005A each
EUR 170
Description: L-Methionine Standard (3.2 mM), Enzyme Solution L, Buffer L, SAM Assay Solution

Bridge-ItL-MET96

1-1-1005B each
EUR 318.75
Description: L-Methionine Standard (3.2 mM), Enzyme Solution L, Buffer L, SAM Assay Solution

Bridge-ItL-MET100

1-1-1006A each
EUR 148.75
Description: L-Methionine Standard (3.2 mM), Enzyme Solution L, Buffer L, SAM Assay Solution

Bridge-ItL-MET384

1-1-1006B each
EUR 420.75
Description: L-Methionine Standard (3.2 mM), Enzyme Solution L, Buffer L, SAM Assay Solution

france bridge 14 cm

EHCA1200-BR11B14 ea
EUR 72

france bridge 11 cm

EHCA1200-BR11B15-1 ea
EUR 72

Bridge-ItL-Tryptophan50

1-1-1001A each
EUR 170
Description: 1 mM L-tryptophan standard in H20, L-Tryptophan Assay Solution A, Buffer W, Buffer C

Bridge-ItL-Tryptophan96

1-1-1001B each
EUR 318.75
Description: 1 mM L-tryptophan standard in H20, L-Tryptophan Assay Solution A, Buffer W, Buffer C

Bridge-ItL-Tryptophan100

1-1-1002A each
EUR 148.75
Description: 1 mM L-tryptophan standard in H20, L-Tryptophan Assay Solution A, Buffer W, Buffer C

Bridge-ItL-Tryptophan384

1-1-1002B each
EUR 420.75
Description: 1 mM L-tryptophan standard in H20, L-Tryptophan Assay Solution A, Buffer W, Buffer C

Bridge for 15ml tube - EACH

HOM2650 EACH
EUR 487.64

Bridge for 50ml tube - EACH

HOM2654 EACH
EUR 487.64

long bridge. migration field 8.5 cm.

EHCA1200-BR11B03 ea
EUR 72

long bridge. migration field 11 cm.

EHCA1200-BR11B04 ea
EUR 72

IC bridge for use with IC circulators - EACH

BAT7546 EACH
EUR 198.45

france bridge, 8.5 cm, for strips of 2.5x14 cm or

EHCA1200-BR11B06-1 ea
EUR 72

Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) Antibody

abx238609-100ug 100 ug
EUR 610.8

Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) Antibody

abx238609-100l 100 µl Ask for price

Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) Antibody

abx238609-50l 50 µl
EUR 350

Human Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) ELISA Kit

abx383709-96tests 96 tests
EUR 1093.2

Human Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) ELISA Kit

abx383709-1096tests 10 × 96 tests Ask for price

Human Testis Expressed 14, Intercellular Bridge Forming Factor (TEX14) ELISA Kit

abx383709-596tests 5 × 96 tests Ask for price

Eptifibatide [Map-Har-Gly-Asp-Trp-pro-Cys-NH2 (Disulfide bridge, Map1-Cys6)]

SP-51473-5 5 mg
EUR 351.6

Desmopressin [Map-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bridge, Map1- Cys6); MW; 1069.1]

SP-52240-1 1 mg
EUR 205.2

Octreotide Acetate [D-Phe-Cys-Phe-D-Trp-Lys-Thr-Cys-Thr-Ol (Disulfide Bridge Cys2-Cys7); MW: 119.2]

SP-50201-5 5 mg
EUR 258

Melanotan II, MT-II, Acetate [Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2 (Lactam bridge Asp2-Lys7); MW 124.2]

SP-52189-1 1 mg
EUR 270

?-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22)

SP-100511-1 1 mg
EUR 1448.4

[D-Phe7, D-Trp10]-Somatostatin 14 (7-14) [D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Cys-Thr (Disulfide bridge: Cys2-Cys7); MW: 1049.30]

SP-101558-1 1 mg
EUR 196.8

Val-Asp-(Arg8)-Vasopressin (AA: Val-Asp-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys3-Cys8)) (MW: 1298.48)

SP-89705-1 1 mg
EUR 196.8

[Cys3, 6, Tyr8, Pro10]-Substance P [Arg-Pro-Cys-Pro-Gln-Cys-Phe-Tyr-Gly-Pro-Met-NH2; (Disulfide bridge: Cys3-Cys6); MW: 1295.6]

SP-101328-5 5 mg
EUR 416.4

[Tyr11]-Somatostatin-14 [Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Tyr-Thr-Ser-Cys (Disulfide bridge: Cys3-Cys14); MW 1653.91]

SP-89829-1 1 mg
EUR 196.8

Somatostatin-14 [Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-THr-Phe-Thr-Ser-Cys-OH (Disulfide Bridge Cys3-Csy14); MW: 1637.9]

SP-52221-1 5 mg
EUR 343.2

Bridge-It SAM 384