mPEG-NH2, MW 40K

mPEG-NH2, MW 40K 

To Order Contact us: lieven@wlsolutions.be

mPEG-GAA,40K

33-MF001014-40K
  • EUR 253.20
  • EUR 637.20
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Hydrazide,40K

33-MF001019-40K
  • EUR 237.60
  • EUR 592.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Epoxide,40K

33-MF001021-40K
  • EUR 253.20
  • EUR 592.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-MAL,40K

33-MF001022-40K
  • EUR 282.00
  • EUR 726.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SG,40K

33-MF001027-40K
  • EUR 253.20
  • EUR 652.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SS,40K

33-MF001028-40K
  • EUR 253.20
  • EUR 652.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-GAS,40K

33-MF001029-40K
  • EUR 282.00
  • EUR 726.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SAS,40K

33-MF001030-40K
  • EUR 326.40
  • EUR 873.60
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-NPC,40K

33-MF001034-40K
  • EUR 223.20
  • EUR 548.40
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-OPSS,40K

33-MF001035-40K
  • EUR 356.40
  • EUR 948.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Biotin,40K

33-MF001041-40K
  • EUR 356.40
  • EUR 948.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-DSPE,40K

33-MF001096-40K
  • EUR 297.60
  • EUR 770.40
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-AA,40K

33-MF001121-40K
  • EUR 282.00
  • EUR 726.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-FITC,40K

FL001044-40K-100mg 100mg
EUR 475.2
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-RB,40K

FL001045-40K-50mg 50mg
EUR 534
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-OH,40K

MF001002-40K-10g 10g
EUR 356.4
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-OH,40K

MF001002-40K-50g 50g
EUR 800.4
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-OH,40K

33-A88002-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SH,40K

33-A88003-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Azide,40K

33-A88006-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-AlKyne,40K

33-A88007-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acrylate,40K

33-A88009-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acrylamide,40K

33-A88010-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GA,40K

33-A88012-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SA,40K

33-A88013-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GAA,40K

33-A88014-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SAA,40K

33-A88015-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acid,40K

33-A88017-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Epoxide,40K

33-A88021-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-MAL,40K

33-A88022-40K
  • EUR 237.60
  • EUR 592.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SCM,40K

33-A88024-40K
  • EUR 237.60
  • EUR 592.80
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SG,40K

33-A88027-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SS,40K

33-A88028-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GAS,40K

33-A88029-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SAS,40K

33-A88030-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-NPC,40K

33-A88034-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

4-ArmPEG-Acid,40K

33-A44017-40K
  • EUR 208.80
  • EUR 504.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

4-ArmPEG-SG,40K

33-A44027-40K
  • EUR 178.80
  • EUR 415.20
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

4-ArmPEG-SS,40K

33-A44028-40K
  • EUR 178.80
  • EUR 415.20
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-N3,40K

33-MF001006-40K
  • EUR 282.00
  • EUR 726.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-NH2

abx085016-035kDa1g 0.35 kDa; 1 g
EUR 393.6

mPEG-NH2

abx085016-055kDa1g 0.55 kDa; 1 g
EUR 410.4

mPEG-NH2

abx085016-10kDa1g 10 kDa; 1 g
EUR 393.6

mPEG-NH2

abx085016-20kDa1g 20 kDa; 1 g
EUR 393.6

8-ArmPEG-NH2,40K

33-A88005-40K
  • EUR 148.80
  • EUR 326.40
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-NH2-HCl

abx085389-2kDa1g 2 kDa; 1 g
EUR 144

mPEG-NH2?HCl,2K

33-MF001050-2K
  • EUR 279.60
  • EUR 158.40
  • 5G
  • G
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

Methoxy PEG Maleimide lbranched (MW: 40,000)

PEG-40K 100 mg
EUR 270

mPEG-BSA (Molecular Weight: 40,000-linear)

PEG-BSA-40K 100 ug
EUR 343.2

mPEG-Biotinylated (MW: 5000)

PEG-BTN 1 mg
EUR 416.4

R-F-NH2 peptide [H-Arg-Phe-NH2; MW: 32.4]

SP-55347-1 5 mg
EUR 169.2

SKIGKV - NH2 (AA: Ser-Lys-Ile-Gly-Lys-Val-NH2) (MW: 629.81)

SP-88363-5 5 mg
EUR 196.8

Bursin [H-Lys-His-Gly-NH2; MW: 339.4]

SP-55178-5 5 mg
EUR 196.8

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]

SP-55426-1 0.5 mg
EUR 795.6

TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41)

SP-89773-5 5 mg
EUR 270

[Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38]

SP-89775-5 5 mg
EUR 270

[Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44]

SP-89776-5 5 mg
EUR 270

LKRApYLG-NH2 (AA: Leu-Lys-Arg-Ala-pTyr-Leu-Gly-NH2) (MW: 899.03)

SP-101406-1 1 mg
EUR 196.8

Ac-RYYRIK-NH2 [Ac-Arg-Tyr-Tyr-Arg-Ile-Lys-NH2 (MW: 939.14)]

SP-89054-5 5 mg
EUR 270

VLAL (AA: Val-Leu-Ala-Leu-NH2) (MW: 964.16)

SP-86722-5 5 mg
EUR 196.8

Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide)

DNP15-MW 100 ug
EUR 534

Magnetic Wand with rubber grips for SPINE caps

MW-1C 1 WAND
EUR 155
Description: Magnetic Wand with rubber grips for SPINE caps

mPEG-SCM

abx085001-1kDa1g 1 kDa; 1 g
EUR 427.2

mPEG-SCM

abx085001-20kDa1g 20 kDa; 1 g
EUR 460.8

mPEG-SCM

abx085001-30kDa1g 30 kDa; 1 g
EUR 460.8

mPEG-SCM

abx085001-40kDa1g 40 kDa; 1 g
EUR 444

mPEG-SCM

abx085001-5kDa1g 5 kDa; 1 g
EUR 460.8

mPEG-SG

abx085002-10kDa1g 10 kDa; 1 g
EUR 427.2

mPEG-SG

abx085002-2kDa1g 2 kDa; 1 g
EUR 393.6

mPEG-SG

abx085002-40kDa1g 40 kDa; 1 g
EUR 444

mPEG-SG

abx085002-5kDa1g 5 kDa; 1 g
EUR 427.2

mPEG-SS

abx085003-10kDa1g 10 kDa; 1 g
EUR 427.2

mPEG-SS

abx085003-1kDa1g 1 kDa; 1 g
EUR 393.6

mPEG-SS

abx085003-20kDa1g 20 kDa; 1 g
EUR 427.2

mPEG-SS

abx085003-5kDa1g 5 kDa; 1 g
EUR 427.2

mPEG-GAS

abx085004-1kDa1g 1 kDa; 1 g
EUR 444

mPEG-GAS

abx085004-2kDa1g 2 kDa; 1 g
EUR 444

mPEG-GAS

abx085004-40kDa1g 40 kDa; 1 g
EUR 477.6

mPEG-GAS

abx085004-5kDa1g 5 kDa; 1 g
EUR 444

mPEG-SAS

abx085005-10kDa1g 10 kDa; 1 g
EUR 510

mPEG-SAS

abx085005-1kDa1g 1 kDa; 1 g
EUR 477.6

mPEG-SAS

abx085005-20kDa1g 20 kDa; 1 g
EUR 510

mPEG-SAS

abx085005-5kDa1g 5 kDa; 1 g
EUR 510

mPEG-CHO

abx085008-035kDa1g 0.35 kDa; 1 g
EUR 577.2

mPEG-CHO

abx085008-075kDa1g 0.75 kDa; 1 g
EUR 610.8

mPEG-NH2, MW 40K