mPEG-NH2, MW 40K
To Order Contact us: lieven@wlsolutions.be
mPEG-GAA,40K |
||
33-MF001014-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-Hydrazide,40K |
||
33-MF001019-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-Epoxide,40K |
||
33-MF001021-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-MAL,40K |
||
33-MF001022-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-SG,40K |
||
33-MF001027-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-SS,40K |
||
33-MF001028-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-GAS,40K |
||
33-MF001029-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-SAS,40K |
||
33-MF001030-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-NPC,40K |
||
33-MF001034-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-OPSS,40K |
||
33-MF001035-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-Biotin,40K |
||
33-MF001041-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-DSPE,40K |
||
33-MF001096-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-AA,40K |
||
33-MF001121-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-FITC,40K |
||
FL001044-40K-100mg | 100mg | EUR 475.2 |
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-RB,40K |
||
FL001045-40K-50mg | 50mg | EUR 534 |
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-OH,40K |
||
MF001002-40K-10g | 10g | EUR 356.4 |
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-OH,40K |
||
MF001002-40K-50g | 50g | EUR 800.4 |
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-OH,40K |
||
33-A88002-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SH,40K |
||
33-A88003-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-Azide,40K |
||
33-A88006-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-AlKyne,40K |
||
33-A88007-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-Acrylate,40K |
||
33-A88009-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-Acrylamide,40K |
||
33-A88010-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-GA,40K |
||
33-A88012-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SA,40K |
||
33-A88013-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-GAA,40K |
||
33-A88014-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SAA,40K |
||
33-A88015-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-Acid,40K |
||
33-A88017-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-Epoxide,40K |
||
33-A88021-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-MAL,40K |
||
33-A88022-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SCM,40K |
||
33-A88024-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SG,40K |
||
33-A88027-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SS,40K |
||
33-A88028-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-GAS,40K |
||
33-A88029-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-SAS,40K |
||
33-A88030-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
8-ArmPEG-NPC,40K |
||
33-A88034-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
4-ArmPEG-Acid,40K |
||
33-A44017-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
4-ArmPEG-SG,40K |
||
33-A44027-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
4-ArmPEG-SS,40K |
||
33-A44028-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-N3,40K |
||
33-MF001006-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-NH2 |
||
abx085016-035kDa1g | 0.35 kDa; 1 g | EUR 393.6 |
mPEG-NH2 |
||
abx085016-055kDa1g | 0.55 kDa; 1 g | EUR 410.4 |
mPEG-NH2 |
||
abx085016-10kDa1g | 10 kDa; 1 g | EUR 393.6 |
mPEG-NH2 |
||
abx085016-20kDa1g | 20 kDa; 1 g | EUR 393.6 |
8-ArmPEG-NH2,40K |
||
33-A88005-40K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
mPEG-NH2-HCl |
||
abx085389-2kDa1g | 2 kDa; 1 g | EUR 144 |
mPEG-NH2?HCl,2K |
||
33-MF001050-2K |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
Methoxy PEG Maleimide lbranched (MW: 40,000) |
||
PEG-40K | 100 mg | EUR 270 |
mPEG-BSA (Molecular Weight: 40,000-linear) |
||
PEG-BSA-40K | 100 ug | EUR 343.2 |
mPEG-Biotinylated (MW: 5000) |
||
PEG-BTN | 1 mg | EUR 416.4 |
R-F-NH2 peptide [H-Arg-Phe-NH2; MW: 32.4] |
||
SP-55347-1 | 5 mg | EUR 169.2 |
SKIGKV - NH2 (AA: Ser-Lys-Ile-Gly-Lys-Val-NH2) (MW: 629.81) |
||
SP-88363-5 | 5 mg | EUR 196.8 |
Bursin [H-Lys-His-Gly-NH2; MW: 339.4] |
||
SP-55178-5 | 5 mg | EUR 196.8 |
Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] |
||
SP-55426-1 | 0.5 mg | EUR 795.6 |
TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41) |
||
SP-89773-5 | 5 mg | EUR 270 |
[Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38] |
||
SP-89775-5 | 5 mg | EUR 270 |
[Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44] |
||
SP-89776-5 | 5 mg | EUR 270 |
LKRApYLG-NH2 (AA: Leu-Lys-Arg-Ala-pTyr-Leu-Gly-NH2) (MW: 899.03) |
||
SP-101406-1 | 1 mg | EUR 196.8 |
Ac-RYYRIK-NH2 [Ac-Arg-Tyr-Tyr-Arg-Ile-Lys-NH2 (MW: 939.14)] |
||
SP-89054-5 | 5 mg | EUR 270 |
VLAL (AA: Val-Leu-Ala-Leu-NH2) (MW: 964.16) |
||
SP-86722-5 | 5 mg | EUR 196.8 |
Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide) |
||
DNP15-MW | 100 ug | EUR 534 |
Magnetic Wand with rubber grips for SPINE caps |
||
MW-1C | 1 WAND | EUR 155 |
Description: Magnetic Wand with rubber grips for SPINE caps |
mPEG-SCM |
||
abx085001-1kDa1g | 1 kDa; 1 g | EUR 427.2 |
mPEG-SCM |
||
abx085001-20kDa1g | 20 kDa; 1 g | EUR 460.8 |
mPEG-SCM |
||
abx085001-30kDa1g | 30 kDa; 1 g | EUR 460.8 |
mPEG-SCM |
||
abx085001-40kDa1g | 40 kDa; 1 g | EUR 444 |
mPEG-SCM |
||
abx085001-5kDa1g | 5 kDa; 1 g | EUR 460.8 |
mPEG-SG |
||
abx085002-10kDa1g | 10 kDa; 1 g | EUR 427.2 |
mPEG-SG |
||
abx085002-2kDa1g | 2 kDa; 1 g | EUR 393.6 |
mPEG-SG |
||
abx085002-40kDa1g | 40 kDa; 1 g | EUR 444 |
mPEG-SG |
||
abx085002-5kDa1g | 5 kDa; 1 g | EUR 427.2 |
mPEG-SS |
||
abx085003-10kDa1g | 10 kDa; 1 g | EUR 427.2 |
mPEG-SS |
||
abx085003-1kDa1g | 1 kDa; 1 g | EUR 393.6 |
mPEG-SS |
||
abx085003-20kDa1g | 20 kDa; 1 g | EUR 427.2 |
mPEG-SS |
||
abx085003-5kDa1g | 5 kDa; 1 g | EUR 427.2 |
mPEG-GAS |
||
abx085004-1kDa1g | 1 kDa; 1 g | EUR 444 |
mPEG-GAS |
||
abx085004-2kDa1g | 2 kDa; 1 g | EUR 444 |
mPEG-GAS |
||
abx085004-40kDa1g | 40 kDa; 1 g | EUR 477.6 |
mPEG-GAS |
||
abx085004-5kDa1g | 5 kDa; 1 g | EUR 444 |
mPEG-SAS |
||
abx085005-10kDa1g | 10 kDa; 1 g | EUR 510 |
mPEG-SAS |
||
abx085005-1kDa1g | 1 kDa; 1 g | EUR 477.6 |
mPEG-SAS |
||
abx085005-20kDa1g | 20 kDa; 1 g | EUR 510 |
mPEG-SAS |
||
abx085005-5kDa1g | 5 kDa; 1 g | EUR 510 |
mPEG-CHO |
||
abx085008-035kDa1g | 0.35 kDa; 1 g | EUR 577.2 |
mPEG-CHO |
||
abx085008-075kDa1g | 0.75 kDa; 1 g | EUR 610.8 |