mPEG-NH2, MW 40K

mPEG-NH2, MW 40K 

To Order Contact us: lieven@wlsolutions.be

mPEG-AC,40K
33-MF001009-40K
  • EUR 223.00
  • EUR 568.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-ACA,40K
33-MF001010-40K
  • EUR 235.00
  • EUR 605.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-GA,40K
33-MF001012-40K
  • EUR 211.00
  • EUR 531.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SA,40K
33-MF001013-40K
  • EUR 211.00
  • EUR 531.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-GAA,40K
33-MF001014-40K
  • EUR 211.00
  • EUR 531.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Hydrazide,40K
33-MF001019-40K
  • EUR 198.00
  • EUR 494.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Epoxide,40K
33-MF001021-40K
  • EUR 211.00
  • EUR 494.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-MAL,40K
33-MF001022-40K
  • EUR 235.00
  • EUR 605.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SG,40K
33-MF001027-40K
  • EUR 211.00
  • EUR 544.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SS,40K
33-MF001028-40K
  • EUR 211.00
  • EUR 544.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-GAS,40K
33-MF001029-40K
  • EUR 235.00
  • EUR 605.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-SAS,40K
33-MF001030-40K
  • EUR 272.00
  • EUR 728.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-NPC,40K
33-MF001034-40K
  • EUR 186.00
  • EUR 457.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-OPSS,40K
33-MF001035-40K
  • EUR 297.00
  • EUR 790.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-Biotin,40K
33-MF001041-40K
  • EUR 297.00
  • EUR 790.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-DSPE,40K
33-MF001096-40K
  • EUR 248.00
  • EUR 642.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-AA,40K
33-MF001121-40K
  • EUR 235.00
  • EUR 605.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

mPEG-NH2
abx085016-035kDa1g 0.35 kDa; 1 g
EUR 328

mPEG-NH2
abx085016-055kDa1g 0.55 kDa; 1 g
EUR 342

mPEG-NH2
abx085016-10kDa1g 10 kDa; 1 g
EUR 328

mPEG-NH2
abx085016-20kDa1g 20 kDa; 1 g
EUR 328

mPEG-NH2-HCl
abx085389-2kDa1g 2 kDa; 1 g
EUR 120

mPEG-NH2?HCl,2K
33-MF001050-2K
  • EUR 233.00
  • EUR 132.00
  • 5G
  • G
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

Methoxy PEG Maleimide lbranched (MW: 40,000)
PEG-40K 100 mg
EUR 225

mPEG-Biotinylated (MW: 5000)
PEG-BTN 1 mg
EUR 347

mPEG-BSA (Molecular Weight: 40,000-linear)
PEG-BSA-40K 100 ug
EUR 286

R-F-NH2 peptide [H-Arg-Phe-NH2; MW: 32.4]
SP-55347-1 5 mg
EUR 141

SKIGKV - NH2 (AA: Ser-Lys-Ile-Gly-Lys-Val-NH2) (MW: 629.81)
SP-88363-5 5 mg
EUR 164

Bursin [H-Lys-His-Gly-NH2; MW: 339.4]
SP-55178-5 5 mg
EUR 164

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
SP-55426-1 0.5 mg
EUR 663

TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41)
SP-89773-5 5 mg
EUR 225

[Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38]
SP-89775-5 5 mg
EUR 225

[Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44]
SP-89776-5 5 mg
EUR 225

LKRApYLG-NH2 (AA: Leu-Lys-Arg-Ala-pTyr-Leu-Gly-NH2) (MW: 899.03)
SP-101406-1 1 mg
EUR 164

Ac-RYYRIK-NH2 [Ac-Arg-Tyr-Tyr-Arg-Ile-Lys-NH2 (MW: 939.14)]
SP-89054-5 5 mg
EUR 225

4-ArmPEG-Acid,40K
33-A44017-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

4-ArmPEG-SG,40K
33-A44027-40K
  • EUR 149.00
  • EUR 346.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

4-ArmPEG-SS,40K
33-A44028-40K
  • EUR 149.00
  • EUR 346.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-OH,40K
33-A88002-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SH,40K
33-A88003-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Azide,40K
33-A88006-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-AlKyne,40K
33-A88007-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acrylate,40K
33-A88009-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acrylamide,40K
33-A88010-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GA,40K
33-A88012-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SA,40K
33-A88013-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GAA,40K
33-A88014-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SAA,40K
33-A88015-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Acid,40K
33-A88017-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-Epoxide,40K
33-A88021-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-MAL,40K
33-A88022-40K
  • EUR 198.00
  • EUR 494.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SCM,40K
33-A88024-40K
  • EUR 198.00
  • EUR 494.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SG,40K
33-A88027-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SS,40K
33-A88028-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-GAS,40K
33-A88029-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-SAS,40K
33-A88030-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

8-ArmPEG-NPC,40K
33-A88034-40K
  • EUR 174.00
  • EUR 420.00
  • 1g
  • 5g
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound.

VLAL (AA: Val-Leu-Ala-Leu-NH2) (MW: 964.16)
SP-86722-5 5 mg
EUR 164

Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide)
DNP15-MW 100 ug
EUR 445

W-K-Y-M-NH2 [H-Trp-Lys-Tyr-Met-Val-Met-NH2 MW 856.13]
SP-55253-1 0.5 mg
EUR 141

Endomorphin-1 [H-Tyr-Pro-Trp-Phe-NH2; MW: 610.72]
SP-55185-5 5 mg
EUR 164

Endomorphin-2 [H-Tyr-Pro-Phe-Phe-NH2; MW: 571.68]
SP-55186-5 5 mg
EUR 164

MIF-1Tyr [H-Tyr-Pro-Leu-Gly-NH2 MW 447.54]
SP-55187-5 5 mg
EUR 164

Gastrin Tetrapeptide (AA: Trp-Met-Asp-Phe-NH2) (MW: 596.71)
SP-71719-5 5 mg
EUR 164

Antho-Rfamide (AA: Pyr-Gly-Arg-Phe-NH2) (MW: 488.57)
SP-88346-5 5 mg
EUR 225

?-Casomorphin (1-3) amide [Tyr-Pro-Phe-NH2 (MW: 424.50)]
SP-89411-5 5 mg
EUR 164

NH2-PEG-NH2
abx085036-03kDa1g 0.3 kDa; 1 g
EUR 398

NH2-PEG-NH2
abx085036-05kDa1g 0.5 kDa; 1 g
EUR 398

NH2-PEG-NH2
abx085036-06kDa1g 0.6 kDa; 1 g
EUR 398

NH2-PEG4-NH2
abx085427-1g 1 g
EUR 606

NH2-PEG3-NH2
20-abx186613
  • EUR 300.00
  • EUR 606.00
  • 1 g
  • 5 g

Neuropeptide F-8-F-NH2 [Phe-Leu-Phe-Gln-Pro-Gln-Arg-Phe-NH2; MW 181.3]
SP-52282-5 5 mg
EUR 232

FMRF - related peptide, SDPFLRF - NH2 (AA: Ser-Asp-Pro-Phe-Leu-Arg-Phe-NH2) (MW:880.02)
SP-88350-5 5 mg
EUR 225

mPEG-SCM
abx085001-1kDa1g 1 kDa; 1 g
EUR 356

mPEG-SCM
abx085001-20kDa1g 20 kDa; 1 g
EUR 384

mPEG-SCM
abx085001-30kDa1g 30 kDa; 1 g
EUR 384

mPEG-SCM
abx085001-40kDa1g 40 kDa; 1 g
EUR 370

mPEG-SCM
abx085001-5kDa1g 5 kDa; 1 g
EUR 384

mPEG-SG
abx085002-10kDa1g 10 kDa; 1 g
EUR 356

mPEG-SG
abx085002-2kDa1g 2 kDa; 1 g
EUR 328

mPEG-SG
abx085002-40kDa1g 40 kDa; 1 g
EUR 370

mPEG-SG
abx085002-5kDa1g 5 kDa; 1 g
EUR 356

mPEG-SS
abx085003-10kDa1g 10 kDa; 1 g
EUR 356

mPEG-SS
abx085003-1kDa1g 1 kDa; 1 g
EUR 328

mPEG-SS
abx085003-20kDa1g 20 kDa; 1 g
EUR 356

mPEG-NH2, MW 40K