mPEG-NH2, MW 40K
To Order Contact us: lieven@wlsolutions.be
![]() mPEG-OH,40K |
|||
MF001002-40K-50g | Biochempeg | 50g | EUR 667 |
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-SH,40K |
|||
33-MF001003-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-CHO,40K |
|||
33-MF001004-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-AC,40K |
|||
33-MF001009-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-ACA,40K |
|||
33-MF001010-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-GA,40K |
|||
33-MF001012-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-SA,40K |
|||
33-MF001013-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-GAA,40K |
|||
33-MF001014-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-Hydrazide,40K |
|||
33-MF001019-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-Epoxide,40K |
|||
33-MF001021-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-MAL,40K |
|||
33-MF001022-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-SG,40K |
|||
33-MF001027-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-SS,40K |
|||
33-MF001028-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-GAS,40K |
|||
33-MF001029-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-SAS,40K |
|||
33-MF001030-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-NPC,40K |
|||
33-MF001034-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-OPSS,40K |
|||
33-MF001035-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-Biotin,40K |
|||
33-MF001041-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-DSPE,40K |
|||
33-MF001096-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-AA,40K |
|||
33-MF001121-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() mPEG-NH2 |
|||
abx085016-035kDa1g | Abbexa | 0.35 kDa; 1 g | EUR 328 |
|
![]() mPEG-NH2 |
|||
abx085016-055kDa1g | Abbexa | 0.55 kDa; 1 g | EUR 342 |
|
![]() mPEG-NH2 |
|||
abx085016-10kDa1g | Abbexa | 10 kDa; 1 g | EUR 328 |
|
![]() mPEG-NH2 |
|||
abx085016-20kDa1g | Abbexa | 20 kDa; 1 g | EUR 328 |
|
![]() mPEG-NH2-HCl |
|||
abx085389-2kDa1g | Abbexa | 2 kDa; 1 g | EUR 120 |
|
![]() mPEG-NH2?HCl,2K |
|||
33-MF001050-2K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() Methoxy PEG Maleimide lbranched (MW: 40,000) |
|||
PEG-40K | Alpha Diagnostics | 100 mg | EUR 225 |
![]() mPEG-Biotinylated (MW: 5000) |
|||
PEG-BTN | Alpha Diagnostics | 1 mg | EUR 347 |
![]() mPEG-BSA (Molecular Weight: 40,000-linear) |
|||
PEG-BSA-40K | Alpha Diagnostics | 100 ug | EUR 286 |
![]() R-F-NH2 peptide [H-Arg-Phe-NH2; MW: 32.4] |
|||
SP-55347-1 | Alpha Diagnostics | 5 mg | EUR 141 |
![]() SKIGKV - NH2 (AA: Ser-Lys-Ile-Gly-Lys-Val-NH2) (MW: 629.81) |
|||
SP-88363-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() TRH (AA: Pyr-His-Pro-NH2) (MW: 362.41) |
|||
SP-89773-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() [Glu2]-TRH [Pyr-Glu-Pro-NH2; MW: 354.38] |
|||
SP-89775-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() [Phe2]-TRH [Pyr-Phe-Pro- NH2; mw 372.44] |
|||
SP-89776-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() Bursin [H-Lys-His-Gly-NH2; MW: 339.4] |
|||
SP-55178-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)] |
|||
SP-55426-1 | Alpha Diagnostics | 0.5 mg | EUR 663 |
![]() LKRApYLG-NH2 (AA: Leu-Lys-Arg-Ala-pTyr-Leu-Gly-NH2) (MW: 899.03) |
|||
SP-101406-1 | Alpha Diagnostics | 1 mg | EUR 164 |
![]() Ac-RYYRIK-NH2 [Ac-Arg-Tyr-Tyr-Arg-Ile-Lys-NH2 (MW: 939.14)] |
|||
SP-89054-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() 4-ArmPEG-Acid,40K |
|||
33-A44017-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 4-ArmPEG-SG,40K |
|||
33-A44027-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 4-ArmPEG-SS,40K |
|||
33-A44028-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-OH,40K |
|||
33-A88002-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SH,40K |
|||
33-A88003-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-Azide,40K |
|||
33-A88006-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-AlKyne,40K |
|||
33-A88007-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-Acrylate,40K |
|||
33-A88009-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-Acrylamide,40K |
|||
33-A88010-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-GA,40K |
|||
33-A88012-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SA,40K |
|||
33-A88013-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-GAA,40K |
|||
33-A88014-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SAA,40K |
|||
33-A88015-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-Acid,40K |
|||
33-A88017-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-Epoxide,40K |
|||
33-A88021-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-MAL,40K |
|||
33-A88022-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SCM,40K |
|||
33-A88024-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SG,40K |
|||
33-A88027-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SS,40K |
|||
33-A88028-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-GAS,40K |
|||
33-A88029-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-SAS,40K |
|||
33-A88030-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() 8-ArmPEG-NPC,40K |
|||
33-A88034-40K | Biochempeg |
|
|
Description: A high purity chemical with various applications in medical research, drug-release, nanotechnology and new materials research, cell culture. In the study of ligand, polypeptide synthesis support, a graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. |
![]() VLAL (AA: Val-Leu-Ala-Leu-NH2) (MW: 964.16) |
|||
SP-86722-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Rat Monoclonal Anti-Dinitrophenyl (DNP) IgG1, aff pure (w/o azide) |
|||
DNP15-MW | Alpha Diagnostics | 100 ug | EUR 445 |
![]() W-K-Y-M-NH2 [H-Trp-Lys-Tyr-Met-Val-Met-NH2 MW 856.13] |
|||
SP-55253-1 | Alpha Diagnostics | 0.5 mg | EUR 141 |
![]() ?-Casomorphin (1-3) amide [Tyr-Pro-Phe-NH2 (MW: 424.50)] |
|||
SP-89411-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Endomorphin-1 [H-Tyr-Pro-Trp-Phe-NH2; MW: 610.72] |
|||
SP-55185-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Endomorphin-2 [H-Tyr-Pro-Phe-Phe-NH2; MW: 571.68] |
|||
SP-55186-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() MIF-1Tyr [H-Tyr-Pro-Leu-Gly-NH2 MW 447.54] |
|||
SP-55187-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Gastrin Tetrapeptide (AA: Trp-Met-Asp-Phe-NH2) (MW: 596.71) |
|||
SP-71719-5 | Alpha Diagnostics | 5 mg | EUR 164 |
![]() Antho-Rfamide (AA: Pyr-Gly-Arg-Phe-NH2) (MW: 488.57) |
|||
SP-88346-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() NH2-PEG-NH2 |
|||
abx085036-03kDa1g | Abbexa | 0.3 kDa; 1 g | EUR 398 |
|
![]() NH2-PEG-NH2 |
|||
abx085036-05kDa1g | Abbexa | 0.5 kDa; 1 g | EUR 398 |
|
![]() NH2-PEG-NH2 |
|||
abx085036-06kDa1g | Abbexa | 0.6 kDa; 1 g | EUR 398 |
|
![]() NH2-PEG4-NH2 |
|||
abx085427-1g | Abbexa | 1 g | EUR 606 |
|
![]() NH2-PEG3-NH2 |
|||
20-abx186613 | Abbexa |
|
|
|
![]() Neuropeptide F-8-F-NH2 [Phe-Leu-Phe-Gln-Pro-Gln-Arg-Phe-NH2; MW 181.3] |
|||
SP-52282-5 | Alpha Diagnostics | 5 mg | EUR 232 |
![]() FMRF - related peptide, SDPFLRF - NH2 (AA: Ser-Asp-Pro-Phe-Leu-Arg-Phe-NH2) (MW:880.02) |
|||
SP-88350-5 | Alpha Diagnostics | 5 mg | EUR 225 |
![]() mPEG-SCM |
|||
abx085001-1kDa1g | Abbexa | 1 kDa; 1 g | EUR 356 |
|
![]() mPEG-SCM |
|||
abx085001-20kDa1g | Abbexa | 20 kDa; 1 g | EUR 384 |
|
![]() mPEG-SCM |
|||
abx085001-30kDa1g | Abbexa | 30 kDa; 1 g | EUR 384 |
|
![]() mPEG-SCM |
|||
abx085001-40kDa1g | Abbexa | 40 kDa; 1 g | EUR 370 |
|
![]() mPEG-SCM |
|||
abx085001-5kDa1g | Abbexa | 5 kDa; 1 g | EUR 384 |
|
![]() mPEG-SG |
|||
abx085002-10kDa1g | Abbexa | 10 kDa; 1 g | EUR 356 |
|
![]() mPEG-SG |
|||
abx085002-2kDa1g | Abbexa | 2 kDa; 1 g | EUR 328 |
|
![]() mPEG-SG |
|||
abx085002-40kDa1g | Abbexa | 40 kDa; 1 g | EUR 370 |
|
![]() mPEG-SG |
|||
abx085002-5kDa1g | Abbexa | 5 kDa; 1 g | EUR 356 |
|